PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 483aa    MW: 54827.2 Da    PI: 7.0062
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22182.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.48.4e-51111391128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi+evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s + 
  PK22182.1  11 VPPGFRFHPTEEELLHYYLRKKVAFEKIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS-GF 108
                69****************************.9***************964444222455**************************************.99 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                + +gl+ktLvfykgrap+g+k+dW+mheyrl
  PK22182.1 109 KRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-567175IPR003441NAC domain
PROSITE profilePS5100556.00211175IPR003441NAC domain
PfamPF023651.8E-2612139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MNLSINGQSQ VPPGFRFHPT EEELLHYYLR KKVAFEKIDL DVIREVDLNK LEPWDIQEKC  60
KIGSTPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKIIYSGFKR IGLRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD ESSTTTHDST VISNSQLSGD SVSEDGWVVC RVFKKKNYQK  180
SLDSPKGTTS SSMSGDSNII MNNNNNNIHH SIHQQHQHHH HQMSYPKNDG VLDQILHYMG  240
RTCKLENDSL TNNIATTERY HHMSKNTAMG GGGGEAVFGH HHQNFMHLPR LQEIITPTNN  300
NNNNTTNTTT LPSMPLLNDN VSPYKAYNNN NNNSTTTTTT NYDDESYDML METEPASTSD  360
HPKPGSNNRV NDWIALDRLV ASQLNGHHHN REEETTTASK AQLSNCFGDI QNVMSFCTEQ  420
DENDVVQLSS YPYLRSRTTS SSNIIVNNNN NQNYNENDLI WSSFGRSSSS PSSSSDPLCH  480
LSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-491117715170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010100216.11e-171NAC domain-containing protein 43
SwissprotQ84WP61e-111NAC43_ARATH; NAC domain-containing protein 43
TrEMBLW9RML11e-171W9RML1_9R
STRINGPOPTR_0011s15640.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.19e-98NAC family protein